PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G17950.1
Common NameATMYB52, BW52, MYB52
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 249aa    MW: 28925.5 Da    PI: 9.0288
Description myb domain protein 52
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G17950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-18550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+++W++Ia+++  gR++k+c++rw++ 
      AT1G17950.1  5 RGHWRPAEDEKLRELVEQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 50
                     899*****************************.***********996 PP

2Myb_DNA-binding55.51.3e-1757100146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      AT1G17950.1  57 RNPFTEEEEERLLASHRIHGNR-WSVIARFFP-GRTDNAVKNHWHV 100
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.039155IPR017930Myb domain
SMARTSM007179.3E-15453IPR001005SANT/Myb domain
PfamPF002497.7E-17550IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-30598IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27658IPR009057Homeodomain-like
CDDcd001671.75E-13849No hitNo description
PROSITE profilePS5129418.71356106IPR017930Myb domain
SMARTSM007171.3E-1556104IPR001005SANT/Myb domain
PfamPF002491.8E-145799IPR001005SANT/Myb domain
CDDcd001674.09E-125999No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2159104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009737Biological Processresponse to abscisic acid
GO:0030154Biological Processcell differentiation
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0005352anatomyxylem
PO:0005848anatomysecondary xylem
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MMCSRGHWRP AEDEKLRELV EQFGPHNWNA IAQKLSGRSG KSCRLRWFNQ LDPRINRNPF  60
TEEEEERLLA SHRIHGNRWS VIARFFPGRT DNAVKNHWHV IMARRGRERS KLRPRGLGHD  120
GTVAATGMIG NYKDCDKERR LATTTAINFP YQFSHINHFQ VLKEFLTGKI GFRNSTTPIQ  180
EGAIDQTKRP MEFYNFLQVN TDSKIHELID NSRKDEEEDV DQNNRIPNEN CVPFFDFLSV  240
GNSASQGLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3151057107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306856090.0
Genevisible255903_at0.0
Expression AtlasAT1G17950-
AtGenExpressAT1G17950-
ATTED-IIAT1G17950-
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor: R2R3-MYB transcription family
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G17950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G17950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195540.0AY519554.1 Arabidopsis thaliana MYB transcription factor (At1g17950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173237.10.0myb domain protein 52
TrEMBLQ6R0C40.0Q6R0C4_ARATH; MYB transcription factor
STRINGAT1G17950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  5. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  8. Ko JH,Beers EP,Han KH
    Global comparative transcriptome analysis identifies gene network regulating secondary xylem development in Arabidopsis thaliana.
    Mol. Genet. Genomics, 2006. 276(6): p. 517-31
    [PMID:16969662]
  9. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  10. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  11. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  12. Ko JH,Kim WC,Han KH
    Ectopic expression of MYB46 identifies transcriptional regulatory genes involved in secondary wall biosynthesis in Arabidopsis.
    Plant J., 2009. 60(4): p. 649-65
    [PMID:19674407]
  13. Park MY,Kang JY,Kim SY
    Overexpression of AtMYB52 confers ABA hypersensitivity and drought tolerance.
    Mol. Cells, 2011. 31(5): p. 447-54
    [PMID:21399993]
  14. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  15. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]